US6077988A
Expired / Lapsed
US
⏱️ 0.0 years remaining
Synthetic bone matrix
Assignee: MARIEL THERAPEUTICS Inc
•
Filing: 1995-05-18
•
Granted: 2000-06-20
•
Expires: 2015-05-18
Abstract
Abstract Disclosed is an osteogenic device capable of inducing the formation of endochondral bone in a shape conforming substantially to the shape of the device when implanted in a mammalian host. The device includes an osteogenic protein dispersed within a porous matrix comprising a polymer of collagen and glycosaminoglycan cross-linked to an M c value of about 800 to about 60,000. Also disclosed are a method of inducing mammalian bone growth, and a method of inducing conductive bone growth from viable mammalian bone.
Inventors
- 👤 Thangavel Kuberasampath
- 👤 Lawrence Berlowitz Tarrant
Bibliographic Details
Application Number
—
Jurisdiction
US
Data Source
google_patents
Last Synchronized
2026-10-23 12:28
CPC Classifications
A; A61; A61L; A61L27/00; A61L27/14; A61L27/22; A61L27/227; A61L27/40; A61L27/44; A61L27/48; A61F; A61F2/00; A61F2/02; A61F2/28; A61L2430/00; A61L2430/02
Claims Analysis
Total Claims: 10
Claim 1
Independent Claim
67 words
An osteogenic device for inducing formation of endochondral bone in a mammal in a shape conforming substantially to the shape of said device, said device comprising an osteogenic protein dispersed within a biocompatible, synthetic, porous matrix comprising a polymer of collagen and glycosaminoglycan crosslinked ex vivo to an M c value of about 800 to about 60,000 and comprising greater than 1% by weight, of said glycosaminoglycan.
Claim 2
Dependent Claim
67 words
An osteogenic device for inducing formation of endochondral bone in a mammal in a shape conforming substantially to the shape of said device, said device comprising an osteogenic protein dispersed within a biocompatible, synthetic, porous matrix comprising a polymer of collagen and glycosaminoglycan crosslinked ex vivo to an M c value of about 800 to about 60,000 and comprising greater than 1% by weight, of said glycosaminoglycan.
Claim 3
Dependent Claim
17 words
The device of claim 1 wherein said glycosaminoglycan comprises at least 5% by weight of said polymer.
Claim 4
Dependent Claim
20 words
The device of claim 2 wherein said glycosaminoglycan comprises from about 6% to about 15% by weight of said polymer.
Claim 5
Dependent Claim
31 words
The device of claim 1 wherein said glycosaminoglycan is selected from the group consisting of chondroitin 4-sulfate, chondroitin 6-sulfate, hyaluronic acid, dermatan sulfate, keratan sulfate, heparin, heparan sulfate, and combinations thereof.
Claim 6
Dependent Claim
12 words
The device of claim 1 wherein said glycosaminoglycan comprises a sulfate group.
Claim 7
Dependent Claim
11 words
The device of claim 5 wherein said glycosaminoglycan comprises chondroitin 6-sulfate.
Claim 8
Dependent Claim
20 words
The device of claim 1 wherein said polymer is cross-linked to an M c value of between 5,000 and 10,000.
Claim 9
Dependent Claim
88 words
The device of claim 1 wherein said osteogenic protein comprises a pair of subunits constituting a dimer under oxidizing conditions, one of said subnits having an amino acid sequence comprising the amino acid sequence of OP1 (SEQ ID NO:1): 1 10 20 30 40
- STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYV
50 60 70 80 90
- SFRDLGWQDWIIAPEGYARYYCEGECAFPLNSYMNATNHAIVQTL
100 110 120 130
- VHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH such that said subunit, when in combination with the second of said subunits, induces endochondral bone formation in a mammal when disposed within said matrix implanted in said mammal.
Claim 10
Dependent Claim
24 words
The device of claim 1 wherein said polymer is selected from the group consisting of Type I collagen, Type II collagen, and mixtures thereof.
References Cited (Backward Citations)
USPTO Annuity & Maintenance Windows
| Annuity Stage | Window Opens | Payment Deadline | Surcharge Period Until | Estimated Fee | Status |
|---|---|---|---|---|---|
| 3.5 Years (Year 4) | 2003-06-20 | 2003-12-20 | 2004-06-20 | $2000.00 | Window Closed / Lapsed |
| 7.5 Years (Year 8) | 2007-06-20 | 2007-12-20 | 2008-06-20 | $3760.00 | Window Closed / Lapsed |
| 11.5 Years (Year 12) | 2011-06-20 | 2011-12-20 | 2012-06-20 | $7700.00 | Window Closed / Lapsed |