US4625015A
Expired / Lapsed
US
⏱️ 0.0 years remaining
Broad spectrum influenza antisera
Assignee: Scripps Research Institute
•
Filing: 1983-08-29
•
Granted: 1986-11-25
•
Expires: 2003-08-29
Abstract
Abstract Antisera against synthetic peptides which neutralize influenza viruses of differing hemagglutinin subtypes, provide protection against infection by influenza virus and methods of preparing the same are disclosed.
Inventors
- 👤 Nicola Green
- 👤 Stephen Alexander
Bibliographic Details
Application Number
—
Jurisdiction
US
Data Source
google_patents
Last Synchronized
2026-10-23 18:18
CPC Classifications
C; C07; C07K; C07K14/00; C07K14/005; C07K16/00; C07K16/08; C07K16/10; C07K16/108; A; A61; A61K; A61K39/00; C12; C12N; C12N2760/00; C12N2760/00011; C12N2760/16011; C12N2760/16111; C12N2760/16122; C12N2760/16211; C12N2760/16222
Claims Analysis
Total Claims: 18
Claim 1
Independent Claim
29 words
A peptide having an amino acid residue sequence that corresponds to the sequence, form left to right and in the direction of amino-terminus to carboxy-terminus, of the formula. SIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITY.
Claim 2
Dependent Claim
29 words
A peptide having an amino acid residue sequence that corresponds to the sequence, form left to right and in the direction of amino-terminus to carboxy-terminus, of the formula. SIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITY.
Claim 3
Dependent Claim
29 words
A peptide having an amino acid residue sequence that corresponds to the sequence, for left to right and in the direction of amino-terminus to carboxy-terminus, of the formula RGIFGAIAGFIENGWEGMIDGWYGFRHQN.
Claim 4
Dependent Claim
29 words
A peptide having an amino acid residue sequence that corresponds to the sequence, for left to right and in the direction of amino-terminus to carboxy-terminus, of the formula RGIFGAIAGFIENGWEGMIDGWYGFRHQN.
Claim 5
Dependent Claim
29 words
A peptide having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula EKQTRGIFGA.
Claim 6
Dependent Claim
29 words
A peptide having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula EKQTRGIFGA.
Claim 7
Dependent Claim
85 words
A peptide conjugate containing a peptide coupled to a carrier that is capable of inducing the production of antibodies that (a) neutralize the influenza virus subtype to a portion of whose hemagglutinin molecule amino acid residue sequence said peptide corresponds as well as (b) cross-neutralize a second influenza virus of a second subtype, the peptide of said conjugate having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula SIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITY.
Claim 8
Dependent Claim
85 words
A peptide conjugate containing a peptide coupled to a carrier that is capable of inducing the production of antibodies that (a) neutralize the influenza virus subtype to a portion of whose hemagglutinin molecule amino acid residue sequence said peptide corresponds as well as (b) cross-neutralize a second influenza virus of a second subtype, the peptide of said conjugate having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula SIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITY.
Claim 9
Dependent Claim
85 words
A peptide conjugate containing a peptide coupled to a carrier that is capable of inducing the production of antibodies that (a) neutralize the influenza virus subtype to a portion of whose hemagglutinin molecule amino acid residue sequence said peptide corresponds as well as (b) cross-neutralize a second influenza virus of a second subtype, the peptide of said conjugate having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula RGIFGAIAGFIENGWEGMIDGWYGFRHQN.
Claim 10
Dependent Claim
85 words
A peptide conjugate containing a peptide coupled to a carrier that is capable of inducing the production of antibodies that (a) neutralize the influenza virus subtype to a portion of whose hemagglutinin molecule amino acid residue sequence said peptide corresponds as well as (b) cross-neutralize a second influenza virus of a second subtype, the peptide of said conjugate having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula RGIFGAIAGFIENGWEGMIDGWYGFRHQN.
Claim 11
Dependent Claim
85 words
A peptide conjugate containing a peptide coupled to a carrier that is capable of inducing the production of antibodies that (a) neutralize the influenza virus subtype to a portion of whose hemagglutinin molecule amino acid residue sequence said peptide corresponds as well as (b) cross-neutralize a second influenza virus of a second subtype, the peptide of said conjugate having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula EKQTRGIFGA.
Claim 12
Dependent Claim
85 words
A peptide conjugate containing a peptide coupled to a carrier that is capable of inducing the production of antibodies that (a) neutralize the influenza virus subtype to a portion of whose hemagglutinin molecule amino acid residue sequence said peptide corresponds as well as (b) cross-neutralize a second influenza virus of a second subtype, the peptide of said conjugate having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula EKQTRGIFGA.
Claim 13
Dependent Claim
34 words
A receptor molecule raised to a peptide having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula SIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITY.
Claim 14
Dependent Claim
34 words
A receptor molecule raised to a peptide having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula SIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITY.
Claim 15
Dependent Claim
34 words
A receptor molecule raised to a peptide having an amino acid residue sequence that corresponds to the sequence, for left to right and in the direction of amino-terminus to carboxy-terminus, of the formula RGIFGAIAGFIENGWEGMIDGWYGFRHQN.
Claim 16
Dependent Claim
34 words
A receptor molecule raised to a peptide having an amino acid residue sequence that corresponds to the sequence, for left to right and in the direction of amino-terminus to carboxy-terminus, of the formula RGIFGAIAGFIENGWEGMIDGWYGFRHQN.
Claim 17
Dependent Claim
34 words
A receptor molecule raised to a peptide having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula EKQTRGIFGA.
Claim 18
Dependent Claim
34 words
A receptor molecule raised to a peptide having an amino acid residue sequence that corresponds to the sequence, from left to right and in the direction of amino-terminus to carboxy-terminus, of the formula EKQTRGIFGA.
References Cited (Backward Citations)
No citation records indexed.
USPTO Annuity & Maintenance Windows
| Annuity Stage | Window Opens | Payment Deadline | Surcharge Period Until | Estimated Fee | Status |
|---|---|---|---|---|---|
| 3.5 Years (Year 4) | 1989-11-24 | 1990-05-26 | 1990-11-25 | $2000.00 | Window Closed / Lapsed |
| 7.5 Years (Year 8) | 1993-11-24 | 1994-05-26 | 1994-11-25 | $3760.00 | Window Closed / Lapsed |
| 11.5 Years (Year 12) | 1997-11-24 | 1998-05-26 | 1998-11-25 | $7700.00 | Window Closed / Lapsed |